Check out Your Discount

Discount Code

Welcome to Murphy Morgan Gifts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0

Summer Gifts

Summer designs on top quality gifts. Look hot and stay cool!

  • sort by
    • Cheeky Cherries Fruit Cotton Shopping Tote Bag
    Cheeky Cherries Fruit Cotton Shopping Tote Bag
    A cheeky design with plump red cherries. Great for all fruit lovers! This 100% cotton tote bag is perfect for your next shopping trip. This quality cotton tote bag does it all. Ideal for running quick errands and shopping trips, this is the bag you take with you instead of using plastic bags.
    £17.99
    Details Add To Cart
    Delicious Strawberry Fruit Cotton Shopping Tote Bag
    Delicious Strawberry Fruit Cotton Shopping Tote Bag
    A delicious design with strawberries. Great for all fruit lovers! This 100% cotton tote bag is perfect for your next shopping trip. This quality cotton tote bag does it all. Ideal for running quick errands and shopping trips, this is the bag you take with you instead of using plastic bags.
    £17.99
    Details Add To Cart
    Ice Cream Tempting Treat Coffee Mug
    Ice Cream Tempting Treat Coffee Mug
    A delicious ice cream is a very tempting treat! Great for all ice cream lovers! Beautiful ceramic coffee mug. Perfect for that strong coffee boost in the morning. The C-shaped easy-grip handle helps keep the cup steady even in a rush.
    £6.99
    Details Add To Cart
    Cheeky Cherries Fruit Summer Long Sleeve T-Shirt
    Sale
    Cheeky Cherries Fruit Summer Long Sleeve T-Shirt
    A cheeky design with plump red cherries. Look great with this fruit summer tee. This classic unisex long sleeve tee fits like a well-loved favorite. Casually elegant with an excellent quality print, it is an irreplaceable everyday item for anyone. 100% Airlume combed and ring-spun cotton
    £19.99 £17.99
    Details Add To Cart
    Cute Cartoon Dolphin Long Sleeve T-Shirt
    Sale
    Cute Cartoon Dolphin Long Sleeve T-Shirt
    A cute cartoon bottlenose dolphin. Great for all dolphin lovers! This classic unisex long sleeve tee fits like a well-loved favorite. Casually elegant with an excellent quality print, it is an irreplaceable everyday item for anyone. 100% Airlume combed and ring-spun cotton.
    £19.99 £17.99
    Details Add To Cart
    Cheeky Cherries Fruit Summer T-Shirt
    Cheeky Cherries Fruit Summer T-Shirt
    A cheeky design with plump red cherries. Look great with this fruit summer tee. The unisex soft-style t-shirt puts a new spin on casual comfort Made from very soft materials, this tee is 100% cotton for solid colors.
    £14.99
    Details Add To Cart
    Juicy Pear Fruit Summer T-Shirt
    Juicy Pear Fruit Summer T-Shirt
    A juicy design with light green pears. Look great with this fruit summer tee. The unisex soft-style t-shirt puts a new spin on casual comfort. Made from very soft materials, this tee is 100% cotton for solid colors.
    £14.99
    Details Add To Cart
    10 product(s) found for "Summer Gifts"
    Product Added to your Cart
    x

    -------- OR --------

    document.addEventListener("DOMContentLoaded", () => { window.cookieconsent.initialise({"palette":{"popup":{"background":"#C62828","text":"#FFFFFF"},"button":{"background":"#fff","text":"#C62828"}},"content":{"message":"This website uses cookies to ensure you get the best experience on our website.","dismiss":"Got It!","link":"Learn More"},"theme":"block","position":"bottom","scheme":"7","type":"opt-in","onInitialise":CookieConsentInit(),"onStatusChange":CookieConsentStatus(),"showLink":false}); }); var g_fws_domain = 'https://www.murphymorgangifts.com'; var g_fws_url='https://www.murphymorgangifts.com/index.aspx?pageid=OG4UA'; var g_fws_cart_url='/'; var g_fws_ssl = 1; var g_fws_lang = 57596; var g_fws_account_type=1; var g_fws_sk=973633; var sessionid= 'vzbwi401cblq04kxotfyngbx'; var g_fws_pages = [{"pageId":"OG4UA","storeId":"973633","name":"Home","length":2225,"pageType":1,"navigation":true,"hidden":false,"sequence":0,"externalURL":null,"linkTarget":null,"seo":{"title":"Murphy Morgan Gifts | U.K. | T-Shirts, Mugs","keywords":["t-shirts","mugs","coffee mugs","hoodies","sweatshirts","long sleeve tees","tote bags","gifts","gift shop uk","t-shirt shop","t-shirt gifts uk","murphy morgan gifts home page"],"description":"Murphy Morgan Gifts online clothing and gift shop.","url":null,"created":"2024-09-26T15:42:34.99+00:00","updated":"2025-06-03T10:44:50.616+00:00"},"redirects":null,"translations":null},{"pageId":"brl40","storeId":"973633","name":"About Us","length":5261,"pageType":2,"navigation":true,"hidden":false,"sequence":1,"externalURL":null,"linkTarget":null,"seo":{"title":"About Us","keywords":["about us murphy morgan gifts","murphy morgan gifts","murphy morgan gifts info","murphy morgan gifts location","best t-shirt gift shop uk"],"description":"About Us page for Murphy Morgan Gifts.","url":"about-us","created":"2024-09-26T12:37:42.656+00:00","updated":"2025-03-31T14:45:15.408+00:00"},"redirects":null,"translations":null},{"pageId":"Scj1J","storeId":"973633","name":"Shipping","length":3334,"pageType":11,"navigation":true,"hidden":false,"sequence":2,"externalURL":null,"linkTarget":null,"seo":{"title":"Shipping","keywords":["shipping prices for murphy morgan gifts","shipping prices","postage and packaging for murphy morgan gifts","p&p murphy morgan gifts","murphy morgan gifts"],"description":"Shipping prices for Murphy Morgan Gifts.","url":"shipping","created":"0001-01-01T00:00:00+00:00","updated":"2025-06-07T14:01:54.9+00:00"},"redirects":null,"translations":null},{"pageId":"kwA4Q","storeId":"973633","name":"Returns & Exchanges","length":9530,"pageType":11,"navigation":true,"hidden":false,"sequence":3,"externalURL":null,"linkTarget":null,"seo":{"title":"Returns & Exchanges","keywords":["returns and exchanges page","murphy morgan gifts returns and exchanges page","returns page murphy morgan gifts","exchanges page murphy morgan gifts","cancellations page murphy morgan gifts"],"description":"Returns and exchanges page for Murphy Morgan Gifts.","url":"returnsandexchanges","created":"0001-01-01T00:00:00+00:00","updated":"2025-05-13T15:57:53.362+00:00"},"redirects":null,"translations":null},{"pageId":"hpZnj","storeId":"973633","name":"Refunds","length":7848,"pageType":11,"navigation":true,"hidden":false,"sequence":4,"externalURL":null,"linkTarget":null,"seo":{"title":"Refunds","keywords":["refunds page","murphy morgan gifts refunds page","murphy morgan gifts refunds","murphy morgan gifts help. murphy morgan refunds help page"],"description":"Refunds page for Murphy Morgan Gifts.","url":"refunds","created":"0001-01-01T00:00:00+00:00","updated":"2025-03-31T14:04:42.301+00:00"},"redirects":null,"translations":null},{"pageId":"SHHsx","storeId":"973633","name":"GPSR","length":4519,"pageType":11,"navigation":true,"hidden":false,"sequence":5,"externalURL":null,"linkTarget":null,"seo":{"title":"GPSR","keywords":["gpsr for murphy morgan gifts","general product safety regulation for murphy morgan gifts","product info murphy morgan gifts","product care instructions for murphy morgan gifts"],"description":"General product safety regulation (GPSR). As required by the EU. All information about our products is listed here.","url":"gpsr","created":"0001-01-01T00:00:00+00:00","updated":"2025-04-15T11:04:40.22+00:00"},"redirects":null,"translations":null},{"pageId":"Www8h","storeId":"973633","name":"F.A.Q.s","length":6212,"pageType":17,"navigation":true,"hidden":false,"sequence":6,"externalURL":null,"linkTarget":null,"seo":{"title":"Frequently Asked Questions","keywords":["faq page","faq murphy morgan gifts","murphy morgan gifts frequently asked questions page","murphy morgan gifts questions and answers","murphy morgan gifts info"],"description":"FAQ page for Murphy Morgan Gifts. Here you will find the answers to the most frequently asked questions, including any other info you may need to know.","url":"faq","created":"0001-01-01T00:00:00+00:00","updated":"2025-06-07T14:06:12.971+00:00"},"redirects":null,"translations":null},{"pageId":"QBY3k","storeId":"973633","name":"Special Offers","length":0,"pageType":7,"navigation":true,"hidden":false,"sequence":7,"externalURL":null,"linkTarget":null,"seo":{"title":"Special Offers","keywords":["special offers","products on sale","murphy morgan gifts special offers","murphy morgan gifts sale","murphy morgan gifts products on sale","murphy morgan gifts items on special offers"],"description":"Special offers for products giving a discount sale for Murphy Morgan Gifts.","url":"specialoffers","created":"2024-09-26T12:37:42.752+00:00","updated":"2024-10-31T16:27:45.86+00:00"},"redirects":[{"url":"offers","permanent":null}],"translations":null},{"pageId":"4R1vZ","storeId":"973633","name":"Discount Code","length":599,"pageType":11,"navigation":true,"hidden":false,"sequence":8,"externalURL":null,"linkTarget":null,"seo":{"title":"Discount Code","keywords":["discount code","murphy morgan gifts discount code","murphy morgan gifts money off coupon","murphy morgan gifts special offers","t-shirt shop uk discount coupon code"],"description":"Enjoy 10% off all orders sitewide in the sales with a discount coupon code: DAD10","url":"discountcode","created":"0001-01-01T00:00:00+00:00","updated":"2025-06-03T10:47:17.924+00:00"},"redirects":null,"translations":null},{"pageId":"Xgz3P","storeId":"973633","name":"My Blog","length":0,"pageType":13,"navigation":true,"hidden":false,"sequence":9,"externalURL":"https://murphymorgangiftshopblog.wordpress.com/","linkTarget":"_blank","seo":null,"redirects":null,"translations":null},{"pageId":"cfOiW","storeId":"973633","name":"Instagram Gallery","length":0,"pageType":14,"navigation":true,"hidden":false,"sequence":10,"externalURL":null,"linkTarget":null,"seo":{"title":"Instagram Gallery","keywords":["murphy morgan gifts instagram gallery","murphy morgan gifts social media","murphy morgan gifts products","murphy morgan gift product images","murphy morgan gifts photos"],"description":"Murphy Morgan Gifts Instagram Gallery. All our latest posts of product photos, videos and info.","url":null,"created":"2024-09-26T12:39:17.015+00:00","updated":"2025-02-12T12:34:41.974+00:00"},"redirects":null,"translations":null},{"pageId":"Fimb7","storeId":"973633","name":"Contact","length":0,"pageType":6,"navigation":true,"hidden":false,"sequence":11,"externalURL":null,"linkTarget":null,"seo":{"title":"Contact Us","keywords":["contact page morphy morgan gifts","how do i contact murphy morgan gifts?","contact page murphy morgan gifts","contact details for murphy morgan gifts","contact muphy morgan t-shirt shop"],"description":"Contact page details for Murphy Morgan Gifts shop.","url":"contact-us","created":"2024-09-26T12:37:42.751+00:00","updated":"2025-03-31T14:24:57.774+00:00"},"redirects":null,"translations":null},{"pageId":"8OgXL","storeId":"973633","name":"Cart","length":0,"pageType":3,"navigation":true,"hidden":false,"sequence":12,"externalURL":null,"linkTarget":null,"seo":null,"redirects":null,"translations":null},{"pageId":"F5V6U","storeId":"973633","name":"Privacy Policy","length":3484,"pageType":5,"navigation":false,"hidden":false,"sequence":13,"externalURL":null,"linkTarget":null,"seo":{"title":"Privacy Policy","keywords":["policy murphy morgan gifts","policy page","policy","terms and conditions"],"description":"Policy page for Murphy Morgan Gifts","url":"privacy-policy","created":"2024-09-26T12:37:43.012+00:00","updated":"2025-04-15T10:36:21.47+00:00"},"redirects":null,"translations":null},{"pageId":"YlQsu","storeId":"973633","name":"Terms","length":10282,"pageType":4,"navigation":false,"hidden":false,"sequence":14,"externalURL":null,"linkTarget":null,"seo":{"title":"Terms and Conditions","keywords":["terms of service","terms and conditions","terms murphy morgan gifts","terms"],"description":"Terms and conditions of service for Murphy Morgan gifts","url":"terms-page","created":"2024-09-26T12:37:43.432+00:00","updated":"2024-09-28T10:36:29.513+00:00"},"redirects":null,"translations":null},{"pageId":"hBCyN","storeId":"973633","name":"My Blog","length":0,"pageType":15,"navigation":false,"hidden":true,"sequence":15,"externalURL":null,"linkTarget":null,"seo":null,"redirects":null,"translations":null},{"pageId":"hZvqQ","storeId":"973633","name":"Christmas Shipping","length":2156,"pageType":11,"navigation":false,"hidden":true,"sequence":16,"externalURL":null,"linkTarget":null,"seo":{"title":"Christmas Shipping","keywords":["murphy morgan gifts christmas shipping","murphy morgan gifts christmas postal dates","murphy morgan gifts christmas last shipping dates","murphy morgan gifts shipping"],"description":"Christmas shipping dates info for Murphy Morgan Gifts. Find out the last Christmas postal dates for buying your Christmas orders.","url":"christmas-shipping","created":"0001-01-01T00:00:00+00:00","updated":"2024-12-06T17:03:21.686+00:00"},"redirects":null,"translations":null},{"pageId":"7aAFb","storeId":"973633","name":"Order Success","length":271,"pageType":9,"navigation":false,"hidden":false,"sequence":1000,"externalURL":null,"linkTarget":null,"seo":{"title":"Order Success!","keywords":["order success page","murphy morgan success order page","murphy morgan ordering page","order success page confirmation murphy morgan gifts"],"description":"Order success page confirmation for Murphy Morgan Gifts.","url":"order-success","created":"2024-09-26T12:37:42.872+00:00","updated":"2024-10-31T15:27:15.884+00:00"},"redirects":null,"translations":null},{"pageId":"C3w59","storeId":"973633","name":"Order Failed","length":463,"pageType":10,"navigation":false,"hidden":false,"sequence":1000,"externalURL":null,"linkTarget":null,"seo":{"title":"Order Failed","keywords":["order failed page","murphy morgan gifts order failed page","murphy morgan gifts ordering page"],"description":"Order failed page for Murphy Morgan Gifts","url":"order-failed","created":"2024-09-26T12:37:42.752+00:00","updated":"2024-10-31T15:32:03.008+00:00"},"redirects":null,"translations":null},{"pageId":"OfcZN","storeId":"973633","name":"Details","length":0,"pageType":12,"navigation":false,"hidden":false,"sequence":1000,"externalURL":null,"linkTarget":null,"seo":null,"redirects":null,"translations":null},{"pageId":"ebDji","storeId":"973633","name":"Browse","length":0,"pageType":8,"navigation":false,"hidden":false,"sequence":1000,"externalURL":null,"linkTarget":null,"seo":null,"redirects":null,"translations":null}]; var g_fws_categories = [{"id":"711644","storeId":"973633","name":"T-Shirts","parent":"0","hidden":false,"description":true,"sequence":0,"image":"coolmrredhotpepperblackmodel_1729777708140.png","googleCategory":"Clothing & Accessories > Clothing > Shirts & Tops","seo":{"custom_url":"tshirts","title":"T-Shirts","keywords":"t-shirts uk, tee uk, t-shirt gifts uk, murphy morgan gifts t-shirts, tee gifts uk, softstyle t-shirts, Unisex Softstyle T-Shirt Gildan 64000, unisex t-shirts uk, unisex tees uk, t-shirts for sale uk, t-shirts where to buy, hand made t-shirts uk, print design tees uk, unique designs t-shirts uk, trendy tees uk, skull t-shirts uk, fruit t-shirts uk, christmas t-shirts uk, cat tees uk, dog tees uk, murphy morgan gifts","description":"Find amazing, unique designs on classic fit versatile style tees that can match any occasion, whether it's formal or semi-formal. These t-shirts are great to wear any time or buy them as special gifts for friends or family."}},{"id":"426775","storeId":"973633","name":"Long Sleeve Tees","parent":"0","hidden":false,"description":true,"sequence":1,"image":"dogmummothersdaylongsleevetshirtblackwomanfront_1746109871942.jpg","googleCategory":"Clothing & Accessories > Clothing > Shirts & Tops","seo":{"custom_url":"longsleevetees","title":"Long Sleeve Tees","keywords":"long sleeve t-shirts uk, long sleeve tee uk, long sleeve t-shirt gifts uk, murphy morgan gifts long sleeve t-shirts, tee gifts uk, long sleeve cotton t-shirts, Unisex Softstyle T-Shirt Gildan 64000, unisex t-shirts uk, long sleeve unisex tees uk, long sleeve t-shirts for sale uk, long sleeve t-shirts where to buy, hand made long sleeve t-shirts uk, print design long sleeve tees uk, unique designs long sleeve t-shirts uk, trendy long sleeve tees uk, skull long sleeve t-shirts uk, fruit long sleeve t-shirts uk, christmas long sleeve t-shirts uk, cat long sleeve tees uk, dog long sleeve tees uk, murphy morgan gifts","description":"Find amazing, unique designs on classic fit versatile style long sleeve tees that can match any occasion, whether it's formal or semi-formal. These long sleeve t-shirts are great to wear any time or buy them as special gifts for friends or family."}},{"id":"436631","storeId":"973633","name":"Sweatshirts","parent":"0","hidden":false,"description":true,"sequence":2,"image":"","googleCategory":"Clothing & Accessories > Clothing > Shirts & Tops","seo":{"custom_url":"sweatshirts","title":"Sweatshirts","keywords":"sweatshirts uk, tee uk, sweatshirt gifts uk, murphy morgan gifts sweatshirts, sweater gifts uk, pullovers uk, jumpers uk, unisex sweatshirts uk, unisex sweaters uk, unisex soft cotton crew neck sweatshirt uk, sweatshirts for sale uk, sweatshirts where to buy, hand made sweatshirts uk, print design sweatshirts uk, unique designs sweatshirts uk, trendy sweatshirts uk, skull sweatshirts uk, fruit sweatshirts uk, christmas sweatshirts uk, cat sweatshirts uk, dog sweatshirts uk, murphy morgan gifts","description":"Beautiful and exciting designs on sweatshirt. Keep comfy and warm in the colder weather. These sweatshirts are great to wear any time or buy them as special gifts for friends or family."}},{"id":"667966","storeId":"973633","name":"Hoodies","parent":"0","hidden":false,"description":true,"sequence":3,"image":"","googleCategory":"Clothing & Accessories > Clothing > Shirts & Tops","seo":{"custom_url":"hoodies","title":"Hoodies","keywords":"hoodie sweatshirts uk, hoodies uk, hooded sweatshirt gifts uk, murphy morgan gifts hoodies, hoodies sweatshirts gifts uk, hoodie pullovers uk, hoodie jumpers uk, unisex hoodies uk, unisex hoodie sweaters uk, unisex soft cotton hoodie sweatshirt uk, hoodie sweatshirts for sale uk, hoodie sweatshirts where to buy, hand made hoodies uk, print design hoodies uk, unique designs hoodies sweatshirts uk, trendy hoodies uk, skull hoodies uk, fruit hoodies uk, christmas hoodies sweatshirts uk, cat hoodies uk, dog hoodies uk, murphy morgan gifts","description":"Beautiful and exciting designs on hoodies. Keep comfy and warm in the colder weather. These hoodies are great to wear any time or buy them as special gifts for friends or family."}},{"id":"584626","storeId":"973633","name":"Bags","parent":"0","hidden":false,"description":true,"sequence":4,"image":"","googleCategory":"Luggage & Bags > Shopping Totes","seo":{"custom_url":"bags","title":"Bags","keywords":"bags uk, canvas polyester shoulder tote bags uk, all over print shoulder tote bags uk,murphy morgan gifts bags, premium shoulder tote bags uk, canvas shopping tote bags uk, cotton shopping tote bags uk, re-usable cotton shopping bags uk, shopping tote bags for sale uk, shopping tote bags where to buy uk, cotton tote bags for sale, canvas shoulder tote bags for sale uk, christmas design tote bags uk, christmas design cotton shopping tote bags uk, murphy morgan gifts","description":"Find exciting unique designs on these bags. Try the canvas shoulder tote bag or the cotton shopping tote bag. Both are ideal for your next shopping trip, quick errands or longer travels."}},{"id":"472623","storeId":"973633","name":"Mugs","parent":"0","hidden":false,"description":true,"sequence":5,"image":"redpoppieswatercolourpatternmug2_1739551059875.jpg","googleCategory":"Home & Garden > Kitchen & Dining > Tableware > Drinkware > Mugs","seo":{"custom_url":"mugs","title":"Mugs","keywords":"mugs uk, ceramic coffee mugs uk, ceramic coffee cups uk, murphy morgan gifts mugs, premium coffee mugs uk, 11 oz coffee mug uk, 15 oz coffee mug uk, coffee mugs for sale uk, coffee mugs where to buy, funny mugs uk, cat mugs uk, dog mugs uk, halloween mugs uk, skull mugs uk, christmas mugs uk, flower mugs uk, birthday mugs uk, union jack flag mugs uk, fathers day mugs uk, mothers day mugs uk, murphy morgan gifts","description":"Beautiful ceramic coffee mugs. Thanks to the lead and BPA-free white ceramic with a glossy finish, they'll serve a sleek and polished look. They come in two sizes – 11oz (0.33 l) and 15oz (0.44 l) – perfect for that strong coffee boost in the morning. The C-shaped easy-grip handle helps keep the cup steady even in a rush. Choose your new favourite cup or buy them as a gifts for your friends and family."}},{"id":"382689","storeId":"973633","name":"Father's Day Gifts","parent":"0","hidden":false,"description":true,"sequence":6,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"fathersdaygifts","title":"Father's Day Gifts","keywords":"fathers day gifts uk, fathers day t-shirts uk, fathers day sweatshirts uk, fathers day hoodies uk, fathers day long sleeve tees uk, fathers day mugs, fathers day tote bags, dads day gifts uk, dad t-shirts, dad mugs, dad sweatshirts, dad hoodies, dad tote bags, funny dad t-shirts, funny dad sweatshirts, funny dad hoodies, funny dad mugs, funny dad tote bags, cat dad t-shirts, dog dad t-shirts, zombie dad t-shirts, gamer dad t-shirts, gardener dad t-shirts, diy dad fix it t-shirts, murphy morgan gifts fathers day, murphy morgan gifts","description":"Find the perfect Father's Day gift for your dad."}},{"id":"157731","storeId":"973633","name":"Birthday Gifts","parent":"0","hidden":false,"description":true,"sequence":7,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"birthdaygifts","title":"Birthday Gifts","keywords":"birthday gifts uk, birthday t-shirts uk, birthday sweatshirts uk, birthday hoodies uk, birthday long sleeve tees uk, birthday mugs, birthday tote bags, birthday cake t-shirts, birthday cake mugs, birthday cake sweatshirts, birthday cake hoodies, birthday cake tote bags, its my birthday t-shirts, its my birthday sweatshirts, its my birthday hoodies, its my birthday mugs, its my birthday tote bags, party t-shirts, party sweatshirts, party hoodies, party mugs, party tote bags, murphy morgan gifts birthday, murphy morgan gifts","description":"Gifts with birthday designs. Find t-shirts, mugs, bags and more to help you celebrate your friends and family's birthdays in style."}},{"id":"749451","storeId":"973633","name":"Summer Gifts","parent":"0","hidden":false,"description":true,"sequence":8,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"summergifts","title":"Summer Gifts","keywords":"summer design gifts uk, summer t-shirts uk, summer sweatshirts uk, summer hoodies uk, summer long sleeve tees uk, summer mugs, summer tote bags, fruit gifts uk, fruit t-shirts, fruit design mugs, fruit sweatshirts, fruit hoodies, fruit tote bags, chili pepper t-shirts, shark sweatshirts, fish hoodies, jellyfish mugs, fish tote bags, fish t-shirts, jellyfish t-shirts, flower t-shirts, ice cream t-shirts, beach t-shirts, murphy morgan gifts summer, murphy morgan gifts","description":"Summer designs on top quality gifts. Look hot and stay cool!"}},{"id":"345118","storeId":"973633","name":"Christian Gifts","parent":"0","hidden":false,"description":true,"sequence":9,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"christiangifts","title":"Christian Gifts","keywords":"christian gifts uk, christian t-shirts uk, christian sweatshirts uk, christian hoodies uk, christian long sleeve tees uk, christian mugs, christian tote bags, jesus christ gifts uk, jesus t-shirts, jesus mugs, jesus sweatshirts, jesus hoodies, jesus tote bags, angel t-shirts, angel sweatshirts, angel hoodies, angel mugs, angel tote bags, archangel t-shirts, jesus christ t-shirts, saints t-shirts, catholic t-shirts, religious t-shirts, jesus christ tees, murphy morgan gifts christian, murphy morgan gifts","description":"Christian designs with Jesus and Angels on gifts including t-shirts, mugs, bags and more!"}},{"id":"415315","storeId":"973633","name":"Flower Gifts","parent":"0","hidden":false,"description":true,"sequence":10,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"flowergifts","title":"Flower Gifts","keywords":"flower design gifts uk, flower design t-shirts uk, flower design sweatshirts uk, flower design hoodies uk, flower design long sleeve tees uk, flower design mugs, flower design tote bags, rose t-shirts, rose mugs, rose sweatshirts, rose hoodies, rose tote bags, sunflowers t-shirts, sunflowers sweatshirts, sunflowers hoodies, sunflowers mugs, sunflowers tote bags, poppies t-shirts, poppies sweatshirts, poppy hoodies, poppy mugs, poppy tote bags, murphy morgan gifts flowers, murphy morgan gifts","description":"Beautiful flower designs on a range of top quality products."}},{"id":"147471","storeId":"973633","name":"Cat Gifts","parent":"0","hidden":false,"description":true,"sequence":11,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"catgifts","title":"Cat Gifts","keywords":"cat gifts uk, cat t-shirts uk, cat sweatshirts uk, cat hoodies uk, cat long sleeve tees uk, cat mugs, cat tote bags, black cat t-shirts, black cat mugs, black cat sweatshirts, black cat hoodies, black cat tote bags, ginger cat t-shirts, ginger cat sweatshirts, ginger orange cat hoodies, ginger cat mugs, ginger cat tote bags, murphy morgan gifts halloween, murphy morgan gifts","description":"Exciting gifts with cat designs. Find your favourite t-shirt, mug or bag with a cute furry kitty."}},{"id":"552643","storeId":"973633","name":"Dog Gifts","parent":"0","hidden":false,"description":true,"sequence":12,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"doggifts","title":"Dog Gifts","keywords":"dog gifts uk, dog t-shirts uk, dog sweatshirts uk, dog hoodies uk, dog long sleeve tees uk, dog mugs, dog tote bags, bulldog dog t-shirts, bulldog dog mugs, labrador dog sweatshirts, basset hound dog hoodies, dalmatian dog tote bags, bullmastiff dog t-shirts, alsatian dog sweatshirts, puppy dog hoodies, cavalier King Charles Spaniel mugs, Chihuahua tote bags, murphy morgan gifts dog, murphy morgan gifts","description":"Exciting gifts with dog designs. Find your favourite t-shirt, mug or bag with a cute puppy dog."}},{"id":"583877","storeId":"973633","name":"Food Gifts","parent":"0","hidden":false,"description":true,"sequence":13,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"foodgifts","title":"Food Gifts","keywords":"food design gifts uk, food design t-shirts uk, food design sweatshirts uk, food design hoodies uk, food design long sleeve tees uk, food design mugs, food design tote bags, burger t-shirts, burger mugs, burger sweatshirts, burger hoodies, burger tote bags, donut t-shirts, hot dog sweatshirts, pizza hoodies, ice cream mugs, cup cake tote bags, taco t-shirts, chocolate designs sweatshirts, cake hoodies, chili pepper mugs, fruit tote bags, murphy morgan gifts food, murphy morgan gifts","description":"Gifts with delicious food designs. Find your favourite today!"}},{"id":"293898","storeId":"973633","name":"Funny Quotes Gifts","parent":"0","hidden":false,"description":true,"sequence":14,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"funnygifts","title":"Funny Quotes Gifts","keywords":"funny design gifts uk, funny quotes design t-shirts uk, funny design sweatshirts uk, funny design hoodies uk, funny design long sleeve tees uk, funny design mugs, funny design tote bags, funny slogans t-shirts, funny quotes mugs, funny quotes sweatshirts, funny quotes hoodies, funny quotes tote bags, funny puns t-shirts, funny puns sweatshirts, funny puns hoodies, funny puns mugs, funny puns tote bags, sarcastic t-shirts, sarcastic designs sweatshirts, sarcasm hoodies, sarcasm mugs, sarcastic quotes tote bags, murphy morgan gifts funny, murphy morgan gifts","description":"Funny quotes, sayings and slogans on a range of top quality products. Find a funny gift for your nearest and dearest today!"}},{"id":"953172","storeId":"973633","name":"Cool Quotes Gifts","parent":"0","hidden":false,"description":true,"sequence":15,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"coolquotesgifts","title":"Cool Quotes Gifts","keywords":"cool quote gifts uk, cool quotes t-shirts uk, cool quotes sweatshirts uk, cool quotes hoodies uk, cool quotes long sleeve t-shirts uk, cool quotes coffee mugs uk, cool quotes canvas polyester tote bags, cool quotes cotton shopping tote bags uk, keep calm and carry on t-shirts uk, keep calm and eat chocolate t-shirts uk, keep calm a nd shop on tote bags uk, peachy keen quote t-shirt uk, peachy keen quote cotton tote bag uk, reading lover quotes cotton tote bags uk, book lover quotes cotton tote bags uk, save the planet quotes tote bags uk","description":"Cool quotes, sayings and slogans on a range of top quality products. Find a cool gift for your nearest and dearest today!"}},{"id":"329789","storeId":"973633","name":"Animal Gifts","parent":"0","hidden":false,"description":true,"sequence":16,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"animalgifts","title":"Animal Gifts","keywords":"animals gifts uk, animal t-shirts uk, animal sweatshirts uk, animal hoodies uk, animal long sleeve tees uk, animal mugs, animal tote bags, sealife gifts uk, shark t-shirts, shark mugs, shark sweatshirts, shark hoodies, shark tote bags, fish t-shirts, fish sweatshirts, fish hoodies, fish mugs, fish tote bags, bird t-shirts, seahorse t-shirts, jellyfish t-shirts, bear t-shirts, rabbit t-shirts, chicken tees, murphy morgan gifts animals, murphy morgan gifts","description":"Animal designs on a range of top quality products."}},{"id":"926312","storeId":"973633","name":"British Gifts","parent":"0","hidden":false,"description":true,"sequence":17,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"britishgifts","title":"British Gifts","keywords":"british gifts uk, union jack flag t-shirts uk, union jack flag sweatshirts uk, union jack flag hoodies uk, union jack flag long sleeve tees uk, union jack flag mugs, union jack flag tote bags, english united kingdom gifts, saint george cross flag t-shirts, saint george cross flag mugs, saint george cross flag sweatshirts, saint george cross flag hoodies, saint george cross flag tote bags, english football t-shirts, british football sweatshirts, english football hoodies, british football mugs, british football tote bags, london t-shirts, royal crown t-shirts, british bulldog t-shirts, best of british quote t-shirts, british flag design t-shirts, english flag design tees, murphy morgan gifts british, murphy morgan gifts","description":"A collection of top quality gifts with British designs or style."}},{"id":"694192","storeId":"973633","name":"Halloween Gifts","parent":"0","hidden":false,"description":true,"sequence":18,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"halloweengifts","title":"Halloween Gifts","keywords":"halloween gifts uk, halloween t-shirts uk, halloween sweatshirts uk, halloween hoodies uk, halloween long sleeve tees uk, halloween mugs, halloween tote bags, skull t-shirts, skull mugs, skull sweatshirts, skull hoodies, skull tote bags, zombie t-shirts, zombie sweatshirts, zombie hoodies, zombie mugs, zombie tote bags, murphy morgan gifts halloween, murphy morgan gifts","description":"Get ready for spooky season with this collection of Halloween designs on a range of top quality products."}},{"id":"524776","storeId":"973633","name":"Christmas Gifts","parent":"0","hidden":false,"description":true,"sequence":19,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"christmasgifts","title":"Christmas Gifts","keywords":"Christmas gifts uk, christmas t-shirts uk, christmas sweatshirts uk, christmas hoodies uk, christmas long sleeve tees uk, christmas mugs, christmas tote bags, santa claus t-shirts, santa claus mugs, santa claus sweatshirts, santa claus hoodies, santa claus tote bags, snowman t-shirts, snowman sweatshirts, snowman hoodies, snowman mugs, snowman tote bags, penguin t-shirts, penguin sweatshirts, penguin hoodies, penguin mugs, penguin tote bags, murphy morgan gifts halloween, murphy morgan gifts","description":"Get ready for the festive season with this collection of Christmas designs on a range of top quality products."}},{"id":"769489","storeId":"973633","name":"Saint Patrick's Day Gifts","parent":"0","hidden":false,"description":true,"sequence":20,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"saintpatricksdaygifts","title":"Saint Patrick's Day Gifts","keywords":"saint patricks day gifts, saint patricks day gifts uk, leprechaun t-shirts uk, irish leprechaun t-shirts, happy saint pactircks day t-shirts uk, shamrock t-shirts uk, lucky shamrock tees uk, four leaf clover t-shirts uk, irish shamrock fairy t-shirt, celtic irish knot t-shirts uk, celtic triple knot tees uk celtic triquetra t-shirt uk, celtic triskele t-shirts, triskelion t-shirts uk, funny quotes saint patricks day t-shirts uk, murphy morgan gifts","description":"Celebrate Saint Patrick's Day in style with these top quality products."}},{"id":"872278","storeId":"973633","name":"Valentine's Day Gifts","parent":"0","hidden":false,"description":true,"sequence":21,"image":"","googleCategory":"Clothing & Accessories","seo":{"custom_url":"valentinesdaygifts","title":"Valentine's Day Gifts","keywords":"valentines day design t-shirts, valentines day coffee mugs, valentines day shoulder tote bags, valentines day shopping cotton tote bags, valentines day long sleeve t-shirts, valentines day sweatshirts, valentines day hoodies, heart design t-shirts, rainbow heart design t-shirts, cute baby cupid t-shirts, roses t-shirts, red roses t-shirts, pink roses t-shirts, vintage valentines day t-shirts, funny quotes valentines day t-shirts, black african valentines day design t-shirts","description":"Get ready for love and romance with this collection of Valentine's Day designs on a range of top quality products. Gift your loved ones with t-shirts, coffee mugs, tote bags, long sleeve tees or sweatshirts and hoodies."}},{"id":"467149","storeId":"973633","name":"Mother's Day Gifts","parent":"0","hidden":false,"description":true,"sequence":22,"image":"","googleCategory":"Clothing & Accessories > Clothing > Shirts & Tops","seo":{"custom_url":"mothersdaygifts","title":"Mother's Day Gifts","keywords":"mother's day gifts uk, gifts for mother's day uk,mother's day t-shirts uk, mum t-shirts uk, mum t-shirts mother's day uk, best mum in the world gifts uk, mum coffee mugs mother's day uk, cat mum mother's day t-shirts uk, cat mum mother's day coffee mugs uk, dog mum t-shirts mother's day uk, dog mum coffee mugs mother's day uk, cool mum quotes for mother's day t-shirts uk","description":"Get ready to show your mum some appreciation and that she's the best with this collection of Mother's Day designs on a range of top quality products."}},{"id":"991934","storeId":"973633","name":"Easter Gifts","parent":"0","hidden":false,"description":true,"sequence":23,"image":"","googleCategory":"Clothing & Accessories > Clothing > Shirts & Tops","seo":{"custom_url":"eastergifts","title":"Easter Gifts","keywords":"easter gifts uk, easter t-shirts uk, easter coffee mugs uk, easter sweatshirts uk, easter hoodie uk, easter long sleeve t-shirts uk, easter canvas polyester tote bags uk, easter cotton shopping tote bags uk, easter rabbit t-shirts uk, easter chick t-shirts uk, easter flowers t-shirts uk, jesus christ t-shirts uk, jesus coffee mugs uk, jesus christ sweatshirts uk, jesus christ gifts uk","description":"Get ready for the spring season with this collection of Easter designs on a range of top quality products."}},{"id":"359522","storeId":"973633","name":"Shoulder Tote Bags","parent":"584626","hidden":false,"description":true,"sequence":0,"image":"redrosetotebag3_1729780615874.jpg","googleCategory":"Clothing & Accessories > Handbags, Wallets & Cases > Handbags","seo":{"custom_url":"shouldertotebags","title":"Shoulder Tote Bags","keywords":"bags uk, canvas polyester shoulder tote bags uk, all over print shoulder tote bags uk,murphy morgan gifts bags, premium shoulder tote bags uk, canvas shopping tote bags uk, polyester shopping tote bags uk, re-usable shopping bags uk, shopping tote bags for sale uk, shoulder hand bags uk, shopping tote bags where to buy uk, canvas tote bags for sale, canvas shoulder tote bags for sale uk, christmas design tote bags uk, christmas design cotton shopping tote bags uk, murphy morgan gifts","description":"Find exciting unique designs on these bags. Try the canvas shoulder tote bag. Lightweight, durable, and ideal for your next shopping trip. This quality polyester canvas tote bag does it all. The inside has a sleek, black lining. All over print on both sides of bag. Choose any (or all) of the three sizes—for quick errands, shopping trips, and longer travels."}},{"id":"782188","storeId":"973633","name":"Cotton Shopping Tote Bag","parent":"584626","hidden":false,"description":true,"sequence":1,"image":"whattheduckcottonshoppingbagladymodel_1729781553613.png","googleCategory":"Clothing & Accessories > Handbags, Wallets & Cases > Handbags","seo":{"custom_url":"cottonshoppingtotebags","title":"Cotton Shopping Tote Bags","keywords":"bags uk, cotton shoulder tote bags uk, organic cotton shoulder tote bags uk,murphy morgan gifts bags, premium shoulder tote bags uk, cotton shopping tote bags uk, planet friendly shopping tote bags uk, re-usable shopping bags uk, cotton shopping tote bags for sale uk, shoulder hand bags uk, cotton shopping tote bags where to buy uk, vegan cotton tote bags for sale, cotton shoulder tote bags for sale uk, christmas design tote bags uk, christmas design cotton shopping tote bags uk, murphy morgan gifts","description":"Find exciting unique designs on these bags. The 100% cotton tote bag is perfect for your next shopping trip. This quality cotton tote bag does it all. Ideal for running quick errands and shopping trips, this is the bag you take with you instead of using plastic bags. Choose your favourite design for a unique daily staple that is as fashionable as is practical."}},{"id":"773658","storeId":"973633","name":"Bags - Floral Patterns","parent":"584626","hidden":false,"description":true,"sequence":2,"image":"","googleCategory":"Luggage & Bags > Shopping Totes","seo":{"custom_url":"bags-floralpatterns","title":"Bags - Floral Patterns","keywords":"bags uk, canvas polyester shoulder tote bags uk, all over print shoulder tote bags uk, murphy morgan gifts bags, premium shoulder tote bags uk, canvas shopping tote bags uk, cotton shopping tote bags uk, re-usable cotton shopping bags uk, shopping tote bags for sale uk, shopping tote bags where to buy uk, cotton tote bags for sale, canvas shoulder tote bags for sale uk, christmas design tote bags uk, christmas design cotton shopping tote bags uk, murphy morgan gifts","description":"Floral pattern design bags."}},{"id":"474398","storeId":"973633","name":"Bags - Flower Designs","parent":"584626","hidden":false,"description":true,"sequence":3,"image":"","googleCategory":"Luggage & Bags > Shopping Totes","seo":{"custom_url":"bags-flowerdesigns","title":"bags- Flower Designs","keywords":"bags uk, canvas polyester shoulder tote bags uk, all over print shoulder tote bags uk,murphy morgan gifts bags, premium shoulder tote bags uk, canvas shopping tote bags uk, cotton shopping tote bags uk, re-usable cotton shopping bags uk, shopping tote bags for sale uk, shopping tote bags where to buy uk, cotton tote bags for sale, canvas shoulder tote bags for sale uk, christmas design tote bags uk, christmas design cotton shopping tote bags uk, murphy morgan gifts","description":"Flower design bags."}},{"id":"179865","storeId":"973633","name":"Bags - Paisley Patterns","parent":"584626","hidden":false,"description":true,"sequence":4,"image":"","googleCategory":"Clothing & Accessories > Handbags, Wallets & Cases","seo":{"custom_url":"bags-paisleypatterns","title":"Bags - Paisley Patterns","keywords":"bags uk, canvas polyester shoulder tote bags uk, all over print shoulder tote bags uk,murphy morgan gifts bags, premium shoulder tote bags uk, canvas shopping tote bags uk, cotton shopping tote bags uk, re-usable cotton shopping bags uk, shopping tote bags for sale uk, shopping tote bags where to buy uk, cotton tote bags for sale, canvas shoulder tote bags for sale uk, christmas design tote bags uk, christmas design cotton shopping tote bags uk, murphy morgan gifts","description":"Paisley patterns design bags."}},{"id":"768348","storeId":"973633","name":"Bags - Animal Patterns","parent":"584626","hidden":false,"description":true,"sequence":5,"image":"","googleCategory":"Luggage & Bags > Shopping Totes","seo":{"custom_url":"bags-animalpatterns","title":"Bags - Animal Patterns","keywords":"bags uk, canvas polyester shoulder tote bags uk, all over print shoulder tote bags uk,murphy morgan gifts bags, premium shoulder tote bags uk, canvas shopping tote bags uk, cotton shopping tote bags uk, re-usable cotton shopping bags uk, shopping tote bags for sale uk, shopping tote bags where to buy uk, cotton tote bags for sale, canvas shoulder tote bags for sale uk, christmas design tote bags uk, christmas design cotton shopping tote bags uk, murphy morgan gifts","description":"Animal pattern design bags."}},{"id":"162696","storeId":"973633","name":"Bags - Stripe Patterns","parent":"584626","hidden":false,"description":true,"sequence":6,"image":"","googleCategory":"Clothing & Accessories > Handbags, Wallets & Cases > Handbags","seo":{"custom_url":"bags-stripepatterns","title":"Bags - Stripe Patterns","keywords":"bags uk, canvas polyester shoulder tote bags uk, all over print shoulder tote bags uk,murphy morgan gifts bags, premium shoulder tote bags uk, canvas shopping tote bags uk, cotton shopping tote bags uk, re-usable cotton shopping bags uk, shopping tote bags for sale uk, shopping tote bags where to buy uk, cotton tote bags for sale, canvas shoulder tote bags for sale uk, christmas design tote bags uk, christmas design cotton shopping tote bags uk, murphy morgan gifts","description":"Stripe pattern design bags."}},{"id":"151641","storeId":"973633","name":"Bags - Check Gingham Patterns","parent":"584626","hidden":false,"description":true,"sequence":7,"image":"","googleCategory":"Clothing & Accessories > Handbags, Wallets & Cases > Handbags","seo":{"custom_url":"bags-checkginghampatterns","title":"Bags - Check Gingham Patterns","keywords":"bags uk, canvas polyester shoulder tote bags uk, all over print shoulder tote bags uk,murphy morgan gifts bags, premium shoulder tote bags uk, canvas shopping tote bags uk, cotton shopping tote bags uk, re-usable cotton shopping bags uk, shopping tote bags for sale uk, shopping tote bags where to buy uk, cotton tote bags for sale, canvas shoulder tote bags for sale uk, christmas design tote bags uk, christmas design cotton shopping tote bags uk, murphy morgan gifts","description":"Check and gingham pattern design bags."}},{"id":"341314","storeId":"973633","name":"Bags - Tartan Patterns","parent":"584626","hidden":false,"description":true,"sequence":8,"image":"","googleCategory":"Clothing & Accessories > Handbags, Wallets & Cases > Handbags","seo":{"custom_url":"bags-tartanpatterns","title":"Bags - Tartan Patterns","keywords":"bags uk, canvas polyester shoulder tote bags uk, all over print shoulder tote bags uk,murphy morgan gifts bags, premium shoulder tote bags uk, canvas shopping tote bags uk, cotton shopping tote bags uk, re-usable cotton shopping bags uk, shopping tote bags for sale uk, shopping tote bags where to buy uk, cotton tote bags for sale, canvas shoulder tote bags for sale uk, christmas design tote bags uk, christmas design cotton shopping tote bags uk, murphy morgan gifts","description":"Tartan pattern design bags."}}]; var g_fws_template = "storebuilder/309223/mammoth"; var g_fws_stockctrl = 2; var g_fws_stocklvls = 1; var g_fws_disable_checkout = 0; var g_fws_editmode = false; var g_fws_analyticsId = 'G-435077723'; var g_fws_iid = 'i-0da0bd7442a18eb5b'; var g_fws_ip='216.73.216.207'; var arr_editor_tokens = []; var arr_translate_tokens = [ ];